SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012503 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012503
Domain Number 1 Region: 384-628
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.15e-94
Family Eukaryotic proteases 0.00000111
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000012503
Domain Number - Region: 127-155
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000116
Family Pan module (APPLE domain) 0.058
Further Details:      
 
Domain Number - Region: 222-278
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00883
Family Pan module (APPLE domain) 0.033
Further Details:      
 
Domain Number - Region: 40-64
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0126
Family Pan module (APPLE domain) 0.07
Further Details:      
 
Domain Number - Region: 301-342
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0143
Family Pan module (APPLE domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012503   Gene: ENSBTAG00000009501   Transcript: ENSBTAT00000012503
Sequence length 636
Comment pep:known chromosome:UMD3.1:27:15326026:15346759:1 gene:ENSBTAG00000009501 transcript:ENSBTAT00000012503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIALRQAAYFICLFATVSCGCLTQLYHNIFFRGGDVSAMYTPDAQYCQLMCTFHPRCLLF
SFLPENSTSDADKRFGCFLKDSVTGTLPRVSRTGAISGHSLKRCGHQISACHRSIYKGID
MRGVNFNASKVRSAKECQERCTNNIHCQFFTYATKTFFSAEYRNTCLLKRSPQGTPTRIK
VLSDVESGFSLKACGNSKIGCRVDIFQHSAFSDVDVAGIIAPDAFVCRTICTYHPSCLFF
TFYTNAWKTDSQRNVCFLKTSQSGSPSSPTPQENAISGYSLLTCKQTLPGTEPCHSKIYP
QVAFEGEELHVTFVKGVDGCQETCTKMIRCQFFTYSLFPEDCRGEKCKCSLRLSLDGSPT
NITYGTQASSGYSLRLCKRGDSRVCTTKRTRIVGGTNASWGEWPWQVSLQVKQRAQSHLC
GGSIIGRQWVLTAAHCFDGLLLSNIWRIYGGILNLSEITTETSFSQIKEIIVHPNYKISE
GSHDIALIKLEAPLNFTDLQKAICLPSKDDTKPVYTDCWITGWGFTEEKGKIQNTLQKAN
IPLISNEECQKSYRDYKITKQMICAGYKEGGKDACKGDSGGPLVCQHEETWHLVGITSWG
EGCARREQPGVYTKVAEYVDWILEKTQDSHGQPLRK
Download sequence
Identical sequences Q2KJ63
ENSBTAP00000012503 ENSBTAP00000012503 NP_001039817.1.59421 NP_001039817.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]