SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012583 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012583
Domain Number 1 Region: 715-1037
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-91
Family p120GAP domain-like 0.0000000000134
Further Details:      
 
Domain Number 2 Region: 341-448
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 162-261
Classification Level Classification E-value
Superfamily SH2 domain 9.29e-27
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 467-573
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-24
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 5 Region: 593-729
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-16
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 6 Region: 269-342
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000525
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012583   Gene: ENSBTAG00000009565   Transcript: ENSBTAT00000012583
Sequence length 1044
Comment pep:known_by_projection chromosome:UMD3.1:7:89281002:89391377:1 gene:ENSBTAG00000009565 transcript:ENSBTAT00000012583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEAGGEEGGPVTAGAAGGGAAAASGAYPAVCRVKIPAALPVAAAAPFPGLAEAGVAA
TLGGGAALGSGFLGAGSVAGTPGGVGLSAGGAAAGVAGVAAAAAGAGGEMAFAKGTTSLP
TETFGAGGGFPPLPPPPPQLPTLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYH
GKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQTNVVNHFRIIAMCGDYYIGG
RRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLK
GDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYN
LLMTVGQVCSFLVRPSDNTPGDYSLYFRTSENIQRFKICPTPNNQFMMGGRYYNSIGDII
DHYRKEQIVEGYYLKEPVPMQDQEQVLNDAVDGKEIYNTIRRKTKDAFYKNIVKKGYLLK
KGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQI
VVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLILHIEEA
HKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTK
KSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEY
SEFKELILQKELHVVYALSHVCGQDRTLLASILLKIFLHEKLESLLLCTLNDREISMEDE
ATTLFRATTLASTLMEQYMKATATQFVHHALKDSILRIMESKQSCELSPSKLEKNEDVNT
NLAHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLR
LICPAILNPRMFNIISDSPSPIAARTLTLVAKSVQNLANLVEFGAKEPYMEGVNPFIKSN
KHRMIMFLDELGNVPELPDTTEHSRTDLCRDLAALHEICVAHSDELRTLSNERGAQQHVL
KKLLAITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences F1N7N8
ENSBTAP00000012583 XP_005209786.1.76553 ENSBTAP00000012583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]