SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012726 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012726
Domain Number 1 Region: 241-626
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.61e-158
Family Myotubularin-like phosphatases 0.0000000000108
Further Details:      
 
Domain Number 2 Region: 117-239
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-41
Family GRAM domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012726   Gene: ENSBTAG00000009657   Transcript: ENSBTAT00000012726
Sequence length 684
Comment pep:known_by_projection chromosome:UMD3.1:X:33558564:33634304:1 gene:ENSBTAG00000009657 transcript:ENSBTAT00000012726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRPAAAAAAAAAGCDSGGGLGPGPAGGRRPPRVAGGPAVGSRQPSVETLDSPTGSHVEW
CKQLIAATISSQISGSVTSENVSRDYKEIQEEHNGYPSEAEADQALRDGNKLAQMEEAPL
LPGESIKAIVKDVMYICPFVGAVTGTLTVTDFKMYFKNVERDPHFVLEVPLGVISRVEKI
GAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQTLFAFNYKE
KFPVNGWKVYDPVSEYKRQGLPNESWKISKVNSNYELCDTYPAIIVVPTSVKDDDLSKVA
AFRAKGRIPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQAHKLIIF
DARQNSVADTNKAKGGGYESESAYPNAELMFLEIHNIHVMRESLRKLKEIAYPAIDEARW
LSNVDGTHWLEYIRMLLAGAVRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYY
RTIKGFEALIEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQFPSAFE
FNEFFLITILDHLYSCLFGTFLCNCEQQRLKEDVSTKTVSLWSYINSQLDEFSNPFFVNY
ENHVLYPVASLSHLELWVNYYVRWNPRMRPQTPTHQNLKELLAVRAELQKRVEDLQREVA
ARASASSERGSSPSHSVTPVHTSV
Download sequence
Identical sequences E1BFE6
ENSBTAP00000012726 ENSBTAP00000012726 XP_010819804.1.76553 9913.ENSBTAP00000012726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]