SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012770 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012770
Domain Number 1 Region: 258-413
Classification Level Classification E-value
Superfamily EF-hand 5.98e-21
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 2 Region: 94-250
Classification Level Classification E-value
Superfamily EF-hand 0.000000523
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012770   Gene: ENSBTAG00000009681   Transcript: ENSBTAT00000012770
Sequence length 453
Comment pep:known chromosome:UMD3.1:21:45794781:45820504:-1 gene:ENSBTAG00000009681 transcript:ENSBTAT00000012770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWKEILRRRLATPSTSPHKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDNENSTDLDDT
Download sequence
Identical sequences L8IRK5 Q5E9G1
ENSBTAP00000012770 NP_001015645.1.59421 NP_001015645.1.76553 XP_005891870.1.15283 XP_006043912.1.26621 XP_010833599.1.44457 XP_019839105.1.53367 9913.ENSBTAP00000012770 ENSBTAP00000012770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]