SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012781 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012781
Domain Number 1 Region: 180-309
Classification Level Classification E-value
Superfamily PH domain-like 7.55e-39
Family Pleckstrin-homology domain (PH domain) 0.00000087
Further Details:      
 
Domain Number 2 Region: 456-560
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-24
Family SH2 domain 0.00000443
Further Details:      
 
Domain Number 3 Region: 24-84
Classification Level Classification E-value
Superfamily Phenylalanine zipper 2.35e-22
Family Adapter protein APS, dimerisation domain 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012781   Gene: ENSBTAG00000009691   Transcript: ENSBTAT00000012781
Sequence length 689
Comment pep:known_by_projection chromosome:UMD3.1:25:35192687:35204610:-1 gene:ENSBTAG00000009691 transcript:ENSBTAT00000012781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGGCDGTGAMNGAAPVPVPVPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDA
GASFSRHFAANFLDVFSEEVRRVLVAGPAPPRGAAEPPDAMEPGPAGPPALKAAPYGHSR
SSEDVSATAAAKARVRKGFSLRNMSLCVVDGVRDMWHRRASPEPGAAEPPAEPRDKWMRR
LRLSRTLAAKVQLVDIQREGALRFMVADDAASGPGGAAQWQKCRLLLRRAVAGERFRLEF
FVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWV
ADIQGCVDPGLCRFRVPRPGAAPLANGVRRHPPHIPEVVLIPPLPPSQPSAPHTLCLTPV
KKILTERGTKGQNQGDGDKDTLSFSPLCASVYLIHLFSVIQRASYLQKPNKLIKMTHPCS
ASCGPSVPTPLTLPSSAAEEAAEPEAQAEAELELSDYPWFHGTLSRVKAAQLVLAGGPRN
HGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHFHTHP
IPLESGGSADITLRSYVRAQGPPPGRLYPRLSLGDPGPSPSAAPPPPACWSEPAGQHYFS
SLAAAACPPASPSEAGGASSSSASSSSAASVPGAPRPAAEGPLSARSRSNSAERLLEAAG
GGAEEPPEAGSGEGARGHTRAVENQYSFY
Download sequence
Identical sequences F1MRH8
9913.ENSBTAP00000012781 ENSBTAP00000012781 ENSBTAP00000012781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]