SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012869 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012869
Domain Number 1 Region: 124-368
Classification Level Classification E-value
Superfamily Caspase-like 6.88e-62
Family Caspase catalytic domain 0.0000947
Further Details:      
 
Domain Number 2 Region: 30-110
Classification Level Classification E-value
Superfamily DEATH domain 0.0000541
Family Pyrin domain, PYD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012869   Gene: ENSBTAG00000009760   Transcript: ENSBTAT00000012869
Sequence length 368
Comment pep:known chromosome:UMD3.1:22:12707030:12724264:1 gene:ENSBTAG00000009760 transcript:ENSBTAT00000012869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSLGSGRRSGSDGQPAPPKISPTTEELQSRLQETLDLLSSQELRSFRDHLKKVEPPVS
QVKLELEGHSPSGLAKLLAKHYYPAAVAKRVLVQVLELLPRADLLPRWQSAPTDCPVIPR
KSLKRSYDCVDGELYRYDLSGRRKAFLMCVKKNRLGAHQDVQLMKDWLKECKFEPTLCID
PDKMDLLGKITSFRDELNEIKDDIGCCLVTLMSHGEEGFIKMKDGEKVSLEDIFEMFNNK
NCPALQEKPKIFIIQACRGERRDSGVETDDEPMDLDDGSEKKRLPTFSDYFIVYPTQADH
VALRDPRTGSVMIKEMTEVFKQYGNKWHLADFFTIVNNRVVHRDFNLCNKPVKVSLVMES
TLTKFVYF
Download sequence
Identical sequences L8HS35 Q3T2L0
ENSBTAP00000012869 ENSBTAP00000012869 NP_001029681.1.59421 NP_001029681.1.76553 XP_005909710.1.15283 9913.ENSBTAP00000012869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]