SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012886 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012886
Domain Number 1 Region: 54-181,212-326
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.42e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.054
Further Details:      
 
Domain Number 2 Region: 619-693
Classification Level Classification E-value
Superfamily EF-hand 9.45e-18
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000687
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012886   Gene: ENSBTAG00000009770   Transcript: ENSBTAT00000012886
Sequence length 727
Comment pep:known chromosome:UMD3.1:2:39765206:39912916:-1 gene:ENSBTAG00000009770 transcript:ENSBTAT00000012886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGALATVLGLSHFAHYKRKQVNLAFVEAADCISEPVNREPPSREAQ
ILTLKNTSEFDVLVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVMSLLKKTDPQTGKERVSGARCKDVLTGEEFDVRAKCVINATGPFTDTVRKM
DDKDTTAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTKSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKAHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDSKKEEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
Download sequence
Identical sequences A6QLU1
ENSBTAP00000012886 ENSBTAP00000012886 NP_001093766.1.59421 NP_001093766.1.76553 XP_005202471.1.76553 XP_010838321.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]