SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013262 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013262
Domain Number 1 Region: 21-264
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-73
Family Eukaryotic proteases 0.000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013262   Gene: ENSBTAG00000010057   Transcript: ENSBTAT00000013262
Sequence length 266
Comment pep:known_by_projection chromosome:UMD3.1:21:35264590:35267979:-1 gene:ENSBTAG00000010057 transcript:ENSBTAT00000013262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEREPGGSTSISILGSLSRKMKPLLLLVAFLLTPRAKAGEIIGGHEAKPHSRPYMAYLQY
WNQDVQSRCGGFLVRQDFVLTAAHCNGSSIKVTLGAHNIKQQERTQQVIRVRRAISHPDY
NPKNFSNDIMLLKLERKAKQTSAVKPLSLPRAKARVKPGQTCSVAGWGRDSTDTYADTLQ
EVKLIVQEDQKCEAYLRNFYNRAIQLCVGDPKTKKASFQGDSGGPLVCDNVAQGIVSYGK
RDGSTPRAFTKVSSFLPWIKKTMKSL
Download sequence
Identical sequences F1MTF4
ENSBTAP00000013262 9913.ENSBTAP00000013262 ENSBTAP00000013262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]