SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013320 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013320
Domain Number 1 Region: 602-882
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000023
Further Details:      
 
Domain Number 2 Region: 893-1196
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.75e-78
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000575
Further Details:      
 
Domain Number 3 Region: 361-538
Classification Level Classification E-value
Superfamily Fibronectin type III 1.94e-20
Family Fibronectin type III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013320   Gene: ENSBTAG00000023144   Transcript: ENSBTAT00000013320
Sequence length 1276
Comment pep:known_by_projection chromosome:UMD3.1:16:79522522:79592696:1 gene:ENSBTAG00000023144 transcript:ENSBTAT00000013320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTEEPSTPTSGGPLPARTTASSPANTSKGGKDSSEISPPTSPDSLITKAPPTSWDKNYDR
QSMSFKQPPHFTDSEARPPWVGGQIQTFSPGPRCLIYSRMLMAFVIAGAPGEGTTTTLPA
DPAAPPATSRSPALSSTAASPPLTSNSTTQDNASLPLTSNSTTQDEQTTTPALTTASSVS
PATALSTIAPTKPPCENKYGGVSVKYSFNDNKTFTATLDVKREECEPPGCEKEHRGLSAC
QTKNISMSHPSCEPPFEYVLEVPPDPNQFQLVDCVEDEEANTSLCLHWQNKDFPDNGQFK
CNENKIEYKFKCDGGSPSYNKDTFKVRNLKPRTNYTCSSQVLYDQQLLISQNKTIETDFG
EPEAPQNFTCSAKNATEGKCTWTPPQSYFDRISLCYWITPGGRNCIPQDKTQDGIDLHNL
RPFTNYTVVLQARVTGKVTRSRNATYTFWTDPAKPSKVNGLSASRKTENTIAVSCKRPDQ
LNGPEGKYYLEVRTGNTLVKKDSGPECRFLVEDLQYLTEYNFLVYYDNTKFAGLPESVTA
STSYNAKALIIFLVFLIIVTSIALLIVLYKIYDLHKKRSSNLDEQQELVERDDEKQLMNV
EPIHADVLLETYKRKMADEGRLFLAEFQSIPRVFSKFSIKDARKSFNQNKNRYVDILPYD
YNRVELSDINGDAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVM
VTRCEEGNKNKCAEYWPSMDEGSRVYGDVIVEINEHKRCPDYIIQKLTVGNRKEKASGRA
VTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAML
EGLEAENKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFGETEVSLSELHPYLS
NMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSKIIPYDFNRVALKHE
LETSKESEQDSDESSDDDSDLEEISRYINASFVMSYWKPEVMIAAQGPLKETIGDFWQMV
FQRKVRVIVMLTELKSGDKEACAQYWEEGKQAYGDVEVHMKDTNKSSAYTVRAFELRHSK
RKDPRTVYQYQFNNWNGEELPAEPKELVLMIQNLKQKLPKKNSAEGNKYHRNVPLLIHCR
DGSQQTGIFCALFNLLESADTEEVIDVFQAVKSLRKARPGMVPTFEQYQFLYDVIASTFP
AQNGQVKKSKHPEDKVEIDNEVDKAKPDANCTSPPEALEKTSEGDKEAGGAKPTEGAEGP
EHAANGPASPVLTQSA
Download sequence
Identical sequences F1MJS9
ENSBTAP00000013320 ENSBTAP00000013320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]