SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013434 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013434
Domain Number 1 Region: 27-296
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-86
Family Eukaryotic proteases 0.00000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013434   Gene: ENSBTAG00000010182   Transcript: ENSBTAT00000013434
Sequence length 362
Comment pep:known_by_projection chromosome:UMD3.1:5:120222129:120229501:1 gene:ENSBTAG00000010182 transcript:ENSBTAT00000013434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEMLPTAILLVLAVSVVTRDNTTCDGPCGTRFRQNRQGGMRIIGGQDAAHGSWPWMVSL
QIFTYHNNRRYHVCGGSLLNAHWLLTAAHCFRIKKKVTDWRLIFGAKEVEWGSNKPVKPP
LQERYVEKIIIHEKYSASSEANDIALIKITPPVICGHFIGPGCLPQFRAGPPRVPQTCWV
AGWGFLRENARRTSPVLQEAHVDLIDLDLCNSTRWYNGRIRSTNVCAGYPEGKIDTCQGD
SGGPLMCKDSVENSYVVVGITSWGVGCARAKRPGVYTSTWSYLNWIASKIGSNTVHMIQL
PTAPPASTPAAQASPGSVQPSIRPPWFFQHVPQPPPSQQAIAVASTAHVPRPPQLNPSSS
LP
Download sequence
Identical sequences G5E5C6
ENSBTAP00000013434 ENSBTAP00000013434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]