SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013598 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013598
Domain Number 1 Region: 361-399
Classification Level Classification E-value
Superfamily SAP domain 0.0000000183
Family SAP domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013598   Gene: ENSBTAG00000035706   Transcript: ENSBTAT00000013598
Sequence length 980
Comment pep:known_by_projection chromosome:UMD3.1:19:31767278:31822920:1 gene:ENSBTAG00000035706 transcript:ENSBTAT00000013598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPDSHDSTIIILIFISVLQLRLQQRRTQEQLANQGIVPPLKSPPEFHEQRKRLDSDKAED
TLKRKARSRSDRAAVVKMHILQASTAERSVPTAQMKLKRARLADDLNEKIALRPGPLELV
EKNILPVDSAVKEAIKGNQVTFSKSADAFAFEEDSSSDGLSPDQTRGEDLQGSAGSPPDT
KAMETPLAGPRGTVQDSENERSDPAPHPGNQPDPGKQGLGSLGTPITGHTAVKSKSLSDS
KNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLLQQQQLFLQLQILSQQQ
QHRFSYPGLHAAPPKEPNEQMARNPNASSAPLSNTPLSPAKNSFSGQTGVSSLKPGPLPS
NLDDLKVSELRQQLRIRGLPVSGTKTALMDRLRPFQDCSGNPVPNFGDITTVTFPVTPSN
ALPSYQSSPSTGALSNGFYHFGSTSSSPPISPASSDLSVAGSLPDTFNDASPSFGLHPSP
VPACAEETLMGSLNGGSMLPELDGLDSEKDKMLVEKQKVINELTWKLQQEQRQVEELRLQ
LQKHKRSGCPDKKPPPFPAAPIKQEDAVSSCPFSSRQTAMKRQSTGSEGQPPPPREDTQL
LPLGSTHCAEPSGQTNVLSSTFLSPQCSPQHSPLGAVKSPQHISLPPSPNNHYFLPPSSG
AQGEEHRVSSPVSSQVCTAQNSGAHEGHPPSFSPQPPSLHPPFSGAAADSSHAVGGRPSP
KSPGVQQKMAGLHSSDKAGPKFPIPSPTFSKSTSAVSEITQPPSYEDAVKQQMTRSQQMD
ELLDVLIESGEMPADAREDHSCLHRVPKIPGSSRSPTGALPKSSAAFEPASAGGQLSFDH
FGAESNEHLEVLLNSQSPLGKVSDTTLLKIGSEEPPFDGMMDGFSGKAAEDLFNAHEILP
GPLSPMQTQFSPSSVDSSGLPLSFTESPWESMEWLDLTPPSSTPSFSSLSTGGPSIFNID
FLDVTDLNLNSPMDLHLQQW
Download sequence
Identical sequences G5E5C7
ENSBTAP00000013598 ENSBTAP00000013598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]