SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013614 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013614
Domain Number 1 Region: 193-566
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 3.01e-36
Family Soluble quinoprotein glucose dehydrogenase 0.0027
Further Details:      
 
Domain Number 2 Region: 675-782
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013614   Gene: ENSBTAG00000026913   Transcript: ENSBTAT00000013614
Sequence length 786
Comment pep:known_by_projection chromosome:UMD3.1:21:66284693:66314293:1 gene:ENSBTAG00000026913 transcript:ENSBTAT00000013614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRRAGAGAGAGTLLALLVLRALGAAAHPQCLDFRPPFRPPQPLRFCSQYSAFGCCTPE
QDAALARRFGAVAARVDAAMWAECAGYALDLLCQECSPYVAHLYDAEDPSTPLRTVPGLC
EDYCLDMWQTCRGLFRHLSPDRELWALEGNRAKLCRSLSLDDTDYCFPRLLVNENLNSNL
GRVVADAEGCLQLCLEEVANGLRNPVAMVHARDGTHRFFVAEQLGLVWVYLPDRSRLEKP
FLNISRAVLTSPWEGDERGFLGLAFHPSFRHNGKLYVYYSVGVGFDEWIRISEFRVSEDD
VNAVDHDSERIILEIEEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGKFGNAQNKSA
LLGKVLRIDVDRNERGPLYRIPPDNPFVGDPAARPEVYAFGVRNMWRCSFDRGDPATGAG
RGRLFCGDVGQNKFEEVDLVERGRNYGWRAREGYQCYDRKLCANASLDDVLPIFAYPHKL
GKSVTGGYVYRGCEYPNLNGLYVFGDFMSGRLMSLRENPETGQWRYSEICMGRGQTCAFP
GLINNYYPHIISFGEDEAGELYFMSTGMPSATVAHGVVYKMIDPSRRAPPGKCQIQPSRV
KVRSRLIHFVPKEKFIRRTESTPRPTKAPRRSRPTAAPPAPTPRPPRPTSRPGRRRGSGR
RRGRLGTADPEPSNGAVRLVRPAGLSPGRGRVEVFAGGRWGTVCDDAWDTKAAAVVCRQL
GFLYAARAAKRAEFGEGRTLPILLDDVRCTGSERNLLECAHAGLGSHNCGHQEDAGVVCS
REDPDL
Download sequence
Identical sequences F1MI35
ENSBTAP00000013614 XP_002696881.1.76553 XP_015324087.1.59421 ENSBTAP00000013614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]