SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013699 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013699
Domain Number 1 Region: 113-282
Classification Level Classification E-value
Superfamily EF-hand 1.32e-43
Family Penta-EF-hand proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013699   Gene: ENSBTAG00000010378   Transcript: ENSBTAT00000013699
Sequence length 287
Comment pep:known chromosome:UMD3.1:2:122620933:122638734:1 gene:ENSBTAG00000010378 transcript:ENSBTAT00000013699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYPYGQGCPGAGGQAPGAPPGSYYPGPPHGGGQYGSGVPPGGGYGGGPAPGGPYGPPA
GGGPYGHPHPGGLPSGTPGGPYGGAAPGGPYGTPPPNSFGAGPYGQGPPPPGGVPPNVDP
EAYSWFQSVDSDHSGYISIKELKQALVNSNWSSFNDETCLMMINMFDKTKSGRIDVYGFS
ALWKFIQQWKNLFQQYDRDCSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPA
MQLDRFIQVCTQLQVLTEAFREKDTAVQGSVRLSFEDFVTMTASRML
Download sequence
Identical sequences A5D7S6
NP_001091461.1.59421 NP_001091461.1.76553 XP_019834935.1.53367 ENSBTAP00000013699 9913.ENSBTAP00000013699 ENSBTAP00000013699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]