SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013748 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013748
Domain Number 1 Region: 632-807
Classification Level Classification E-value
Superfamily VPS9 domain 1.96e-21
Family VPS9 domain 0.015
Further Details:      
 
Domain Number 2 Region: 61-185
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000113
Family SH2 domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013748   Gene: ENSBTAG00000010416   Transcript: ENSBTAT00000013748
Sequence length 996
Comment pep:known_by_projection chromosome:UMD3.1:21:57859148:57953844:1 gene:ENSBTAG00000010416 transcript:ENSBTAT00000013748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSFPRGPDLLHPHPPIPDVGKGERQEEEEEDGVGPGLPGTLKNCLPRRDFSVLEKLVKTC
PVWLQLGLGRVEAARILHREAAGTFLVRRDSSLKHLVLCVHFPSLNESSSEVLEYTIKEE
KSILYLEGSVLVFEDIFRLIAFYCVSRDLLPFTLRLPRAILEARSSTDLEIVSNLGLGFW
DSSLNPRRGGGSPAEAPRDPAPGATPASSLKSTAHPENCSCEIELSIGNGRLWFVNPIFI
EDCDRAPPADQPPAGSCPSRPAPPTPDATSPTSRWAPRRPAPPPPPLPLHPPGFSRPPPA
APTPPASPSPSSPPASAPHLAPHAPGPPGLPSQPPMTACERLPRPFAGLDPLREEEMKPG
AAASPLKTPAPPVPTKKSLPAVPPRRRISEKVSLEDQSAGKPDRGAAAEGDPGGPSRASP
LRLPPLRTSDTPGDRPQRTTEPGQEASAQASNPGSAPEPLRKIRQAPVPPPRKKRVSRQL
ASVLPTPQETAELSAAGEAPEKPTPGPPPGEIQGPASPAGGNQSPHAPAGARPQSAPEFK
GSLASLSDSLGVPASAADQDSYSTSSTEEELEQFSSPGMKKKPSMILGKARHRLSFVSFS
NVFNAFLSNNRKLYKKVVELAQDKGSYFGNLVQDYKVYSLEMMSQQTSSTEMLQEIRTMM
TQLKSYLLQSTELKALVDPTLHTEEELEAIVESALYKCVLKPLKEAIYSCLHEIHSKDSS
LQQLKDNQLVILATTTTDLGVTTSVPEVPVMEKILQKFASMHKAYSPEKKISILLKTCKL
IYDSMALGNPGSPLGIDIFFDVLSFYLFGVSNTTKMLAFPTVVFPVVITSPWLGRGVPTM
TTRWQVTLHXKNYDKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEP
EQQSRTLASRADTLAEALCTQCAEKFEVVQPQDYRLFVLVDGRTFQLADEALPHRIKGYL
LRSEPKRDFHFVYRPLDGGGGSGGPPCLVVREPNFL
Download sequence
Identical sequences G5E5D0
ENSBTAP00000013748 ENSBTAP00000013748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]