SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013918 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013918
Domain Number 1 Region: 751-857
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 962-1056
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 201-307
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 512-617
Classification Level Classification E-value
Superfamily SRCR-like 1.18e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 5 Region: 617-719
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1-103
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0021
Further Details:      
 
Domain Number 7 Region: 314-412
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0032
Further Details:      
 
Domain Number 8 Region: 856-961
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0043
Further Details:      
 
Domain Number 9 Region: 105-203
Classification Level Classification E-value
Superfamily SRCR-like 7.85e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 
Domain Number 10 Region: 417-515
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000275
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000013918
Domain Number - Region: 721-752
Classification Level Classification E-value
Superfamily SRCR-like 0.0615
Family Scavenger receptor cysteine-rich (SRCR) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013918   Gene: ENSBTAG00000010522   Transcript: ENSBTAT00000013918
Sequence length 1057
Comment pep:novel chromosome:UMD3.1:26:25714851:25734311:-1 gene:ENSBTAG00000010522 transcript:ENSBTAT00000013918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLAYRPSPCDGVVLVQHEGTWGHVCNREWTLKEASVVCRQLGCGGAVGAPKYVPLPGET
VQPWLHNVSCRGDEASLWGCSLGAWTKSECPYEWVVVALCSNGTFREVRLVKGRSPCAGL
PEIRNVNGVDRLCGLHREEATVFCRELGCGPALQAPRQDGSVARKYMTCGGDELTIRNCR
LNNKFRSGCDFQRDAQVVCSEHTEARLVGGEHSCAGRLEVRRGLTWGTVCDADLDLATAH
VVCRELQCGAAVSTPQGAHFGQGPGLVWAEAFRCVGNESLLFHCPREPGHRCGHGQDAGL
RCSEKAPWGSCPPGGGHRCNGILLLRHQGQLGTACTDTWGFPEAAVVCRELDCGAPLGAP
KEVPGPEIMAQPWLHGLTCQGNESSIQECALGAWGPRPCPHDWVPAVMCMGGLEVVIKLV
GGRSPCAGVPGLQHSNQTLTSCDPQSLEAGTILCKELGCGSMLQAPSPLPETEGPRKGQQ
FVGCEGSEPTVLNCKIDWANFKPCVSNDEVICSGHTEARLVGGEHSCAGRLEVRRGLTWG
TVCDADLDLATAHVVCRELQCGAAVSTPQGAHFGQGPGLVWAEAFRCAGNESLLFHCPRE
PGHRCGHGQDAGLRCSEFRLVNGSSACEGRVELQVQGAWAPLCAAHWDLADATVLCHQLD
CGNAVATPPGGHFGGGASAPWPDEVHCVGTEPYLWSCAVSTLGAPACGPGDAAAAVCSGG
GTEPRLTRCNVSAAALVSAGASRDAGVVCSGSLQVRLAAGPGRCAGRVELLHAGEWGTVC
DDGWDLRDAQVVCRQLGCGHALGAPGAAHFGAGAGRIWMDELACEGHEAALWRCPSRGWG
GHDCGHKEDAGALCSESVALRLRGGAGPCAGWLDVFHNGTWGAVCSNALKDASLSIICQQ
LGCGERGWLENRPGHTSLGTSWVDNIQCRRLRSSTLWQCPSAPWHPHSCTRGEEVWITCA
EEGELRVRGGEDRCSGRVELWHAGSWGTVCDDSWDLADAEVVCRQLGCGRAVDAVAGAAF
GPGSGPVWLDEVGCRGSEASLWGCPAQPWGRVNCGNK
Download sequence
Identical sequences G5E5D7
ENSBTAP00000013918 ENSBTAP00000013918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]