SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014195 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014195
Domain Number 1 Region: 439-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.1e-65
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.57e-22
Family Mib/herc2 domain 0.00079
Further Details:      
 
Domain Number 3 Region: 151-225
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.92e-22
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 66-146
Classification Level Classification E-value
Superfamily RING/U-box 6.56e-21
Family ZZ domain 0.008
Further Details:      
 
Domain Number 5 Region: 900-955
Classification Level Classification E-value
Superfamily RING/U-box 0.00000109
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014195   Gene: ENSBTAG00000010720   Transcript: ENSBTAT00000014195
Sequence length 960
Comment pep:known_by_projection chromosome:UMD3.1:16:52264771:52276754:-1 gene:ENSBTAG00000010720 transcript:ENSBTAT00000014195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDHGT
RTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRICFDYDLCTQCYM
HNKHDLAHAFERYETAHSRPVMLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGK
PGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYRDHLPRL
GKPAELQRRVSADGQPFQRGDKVKCLLDADVLREMQEGHGGWNPRMAKFIGQTGTVHRIT
DRGDVRVQFSHKTRWTFHPGALTKQNSCLVGEVVRVIDDLDTVKRLQAGHGEWTDDMAPA
LGRIGRVLKVFGDGNVGVLVSGKLWTFSPSCLVAYRPEEDANLDVAGRARENKSSLSVVL
DKLRAQKSDLEHPGKLVVEVALGNVARALDLLRRHPEQVDTKNQGRTALQMAAYLGQVEL
VRLLLQAQAGVDLPDDEGNTALHYAALGNQPEAARVLLSSGCGANALNSTRSSALHVAVQ
RGFLEVVKVLCERGCDVNLPDAHADTPLHCAISAGTGASGIVEVLTEVPGIDVTATNSQG
FTLLHHASLKGHTLAVRRILARARQLVDAKKEDGFTALHLAAFNNHGEVAQVLIQEGHCD
VNARNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLAAD
GSAGDPGPLQLLSRLQASGLPSSAELTAGAAMAYYLALEGADLSYANHRGRSPLDLAAEG
RLLKALQGCAQRFRERQAGGSGSGGSAQGPRLVLSAPNTVTNLHVAAPTGPEAAECLVCS
ELALLVLFSPCQHRTVCEGECRVLSQDLSPEPPPLTWTSSADGTEVVSAAPAPGPPRQLV
EELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALSACPICRQPIRDRIQIFV
Download sequence
Identical sequences E1BBN5
ENSBTAP00000014195 ENSBTAP00000014195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]