SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014222 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014222
Domain Number 1 Region: 357-404,442-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000298
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number 2 Region: 596-665
Classification Level Classification E-value
Superfamily EF-hand 0.00000189
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014222   Gene: ENSBTAG00000010742   Transcript: ENSBTAT00000014222
Sequence length 773
Comment pep:known_by_projection chromosome:UMD3.1:26:21056133:21108833:-1 gene:ENSBTAG00000010742 transcript:ENSBTAT00000014222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVGSPEEQELQELGSGAWDNPTYSGPPSPRGTLKIYTISSAVLSQPQPKQPEDGPQEK
AHRTLVSSCCLRICHGIRGLWGTTLTENTAENRELYVKTTLRELLVYVVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTPSDTGISFQAISSMEDFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENLLLGVPRLRQLRVRNDSCMVHEDFREDILSCYDVYSPDEEEQLPFGPL
NGTAWTYHSQDELGGSSHWGQLTSYSGGGYYLDLPGSRRACEEALKDLKEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEIAFC
IFIFYYIVEEILELRIHRLRYLSSIWNILDLVVILLSIMAVGFHIFRTLEVNRLMGKLLQ
QPNMYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFLVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLRQGYNKTLRRLHLRKE
QVSDVQKVLQAGEQEIQFEDFTNTLRELEHTEHETTKLTAAFTRFDQDGNGVLDEKEQKE
TQQKLEGERVAVHAEIENLGWSIVRSPPGESSPKQAAKTGGWVSGEEFYTLTRRVLQLET
VLEGVMTQVDAMRSKLTMVERKGWLAPLPGAGEQGIWEHLQAAPAVTPAPWGL
Download sequence
Identical sequences F1N5R3
ENSBTAP00000014222 XP_015316200.1.76553 XP_015325044.1.59421 ENSBTAP00000014222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]