SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014357 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014357
Domain Number 1 Region: 12-312
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.85e-65
Family Bacterial PLC 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014357   Gene: ENSBTAG00000010822   Transcript: ENSBTAT00000014357
Sequence length 321
Comment pep:known_by_projection chromosome:UMD3.1:20:33030483:33230694:1 gene:ENSBTAG00000010822 transcript:ENSBTAT00000014357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSQGKNELKFADWMATLPESIHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQN
FVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAK
VNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS
LKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKG
SFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVEL
GDFISTVIKLNYVFEEGEANT
Download sequence
Identical sequences F1N4B7
ENSBTAP00000014357 XP_005889781.1.15283 XP_010852018.1.44457 XP_019838692.1.53367 ENSBTAP00000014357 9913.ENSBTAP00000014357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]