SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014364 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014364
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.03e-71
Family Eukaryotic proteases 0.000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014364   Gene: ENSBTAG00000010828   Transcript: ENSBTAT00000014364
Sequence length 250
Comment pep:novel chromosome:UMD3.1:21:35206045:35208959:-1 gene:ENSBTAG00000010828 transcript:ENSBTAT00000014364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLLLLMAFLLPPGLGEPFLSEEIIGGHEAKPHSRPYMAFVQFLGEKSWKRCGGVLIQK
DFVLTAAHCRGSSINVTLGAHNIKQQERTQQVIQVKRAIHHPDYNPKTFSNDIMLLQLER
KAKQTSAVKPLSLPKAKAQVKPGEVCSLAGWGKVALGTPATTLQEVELTVQEDRVCESLN
PRNYSRATQICVGDPRKVKTGFKGDSGGPLVCKKVVHGIFSYGKTNGTPPGVFTQVSHFL
PWIKRTMKHL
Download sequence
Identical sequences E1B8M2
XP_002696734.2.76553 XP_874639.5.59421 ENSBTAP00000014364 ENSBTAP00000014364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]