SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014427 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014427
Domain Number 1 Region: 654-835
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.09e-49
Family ATP-dependent protease Lon (La), catalytic domain 0.00000509
Further Details:      
 
Domain Number 2 Region: 326-575
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.96e-46
Family Extended AAA-ATPase domain 0.0043
Further Details:      
 
Domain Number 3 Region: 12-218
Classification Level Classification E-value
Superfamily PUA domain-like 1.19e-18
Family LON domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014427   Gene: ENSBTAG00000010867   Transcript: ENSBTAT00000014427
Sequence length 852
Comment pep:known chromosome:UMD3.1:18:16739765:16824481:1 gene:ENSBTAG00000010867 transcript:ENSBTAT00000014427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVI
PNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQITQVVREKPYP
VAEVEQLDRLEEFPNTCKTREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQILDAVSLEERFKMTIPLLVRQIEGLKLLQKTRKHKQDDDK
RVIAIRPMRRITHVPGALADEDEDEDNDDIVMLEKKIRTSSMPEQAHKVCVKEIKRLKKM
PQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARVLLDNDHYAMEKLKKRVLEYLAVR
QLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGS
MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAF
DLSQVLFIATANTTASIPPALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGLTPQQ
IQIPQVTTLDIITRYTREAGVRSLDRKLGAICRAVAVKVAEGQHREAKLDRPDVAEGEGC
KEHLLEDGKSDPVSDTTDLALPPEMPILIDFHALKDILGPPMYEMEVSERLSQPGVAIGL
AWTPLGGEIMFVEASRMDGEGQLTLTGQLGNVMKESAHLAISWLRSNAKKYHLTNASGSF
DLLENTDIHLHFPAGAVTKDGPSAGVTIATCLASLFSGRLVRSDVAMTGEITLRGLVLPV
GGIKDKALAAHRAGLKRVIIPQRNEKDLEEIPANVRQDLSFITASCLDEVLNAAFDGGFT
VKARPGLLNSKL
Download sequence
Identical sequences Q3SX23
NP_001029895.1.59421 NP_001029895.1.76553 ENSBTAP00000014427 9913.ENSBTAP00000014427 ENSBTAP00000014427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]