SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014575 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014575
Domain Number 1 Region: 30-153
Classification Level Classification E-value
Superfamily EF-hand 1.06e-25
Family Calmodulin-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014575   Gene: ENSBTAG00000010981   Transcript: ENSBTAT00000014575
Sequence length 159
Comment pep:known_by_projection chromosome:UMD3.1:21:31017716:31023825:1 gene:ENSBTAG00000010981 transcript:ENSBTAT00000014575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLHARFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVEAFSEDGEGNLTF
NDFVDMFSVLCESAPRELKASYAFKIYDFNTDNFICKEDLQLTLARLTKSELDEDEVVLV
CDKVIEEADLDGDGKLGFADFEDMIAKAPDFLRCGSKGL
Download sequence
Identical sequences F1N1B4
ENSBTAP00000014575 ENSBTAP00000014575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]