SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014594 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014594
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000399
Further Details:      
 
Domain Number 2 Region: 615-721
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-31
Family SH2 domain 0.000000653
Further Details:      
 
Domain Number 3 Region: 323-430
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-30
Family SH2 domain 0.000000627
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-17
Family SH3-domain 0.00000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014594   Gene: ENSBTAG00000010989   Transcript: ENSBTAT00000014594
Sequence length 724
Comment pep:known chromosome:UMD3.1:20:11329104:11409885:-1 gene:ENSBTAG00000010989 transcript:ENSBTAT00000014594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGPSKTEADSEQQASTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDTASLDLEMFDVH
VLADAFKRYLLDLPNPVIPVAVSSELISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
Download sequence
Identical sequences P23727
ENSBTAP00000014594 NP_777000.1.59421 NP_777000.1.76553 XP_005221493.1.76553 XP_010851902.1.44457 XP_010851903.1.44457 XP_010851904.1.44457 ENSBTAP00000014594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]