SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014625 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014625
Domain Number 1 Region: 284-437
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-40
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014625   Gene: ENSBTAG00000011011   Transcript: ENSBTAT00000014625
Sequence length 1373
Comment pep:known_by_projection chromosome:UMD3.1:19:21443600:21499794:-1 gene:ENSBTAG00000011011 transcript:ENSBTAT00000014625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFTSSHEVGTLEEERENNPKFFPCSISESFLTVKGAALFLPRGNGSSTPRVSHRRNKHAG
DLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRYMVVVSTNGRQDTEESIVLGMDFSSN
DSSTCTMGLVLPLWSDTLIHLDGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVA
RMHNYYPGSLFLTWVSYYESHINSDQSSVNEWNAMQDVQSHRPDSPALFTDIPTERERTE
RLIKTRLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQI
FEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVYDEEATDLLAYW
NDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKP
NPSFMRQLEEYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKEITTSADQI
AEVKTMESHPPIPPVFVEHVVPQDENQKALCTKERMICLEFTSQEFHAGQIEDELNLNDI
NGCSSGCCLNEPKFPLDNCHASKALIQPGKDPEMAHKFPDLTVEDLETDALKADMNVHLL
PMEELTSRLKDLPMSPDPESPSPQPSCQATVSDFSGDRIDFFSALEKFVELSQETRSRSF
SHSRMEEVGGGRNESCRLSVVEAAPSEATTDDQRSSSLSNTPHASEESSVDEEQSKAISE
QVSPDIFMQPHSENAMSVKEIVTEIESISQGVGQIQVKGDVLSNPCHTPKKHIVHELPLE
RAQAAENRPGNLEQSEGSCPAQPEPAKDSGKGDPEGCPGAHSSTAEVEEEEPVEGEQELW
GPGMPPGAKWYPGSVRRATLEFEERLRQEQEHHGAAPAGTSLSTRKNSKNDSSVADLAAK
GKSDEAAPELSYVPKEPETGRGQGRCGGSESGSLLRPEQLAIVPAPELRESHPAPATQDG
PRHEGILREPRTVVSGQGPETPAAPAAFPKKIEIIEYTYTATSPDPGPGWERASSEKSGA
QGLRTVKVEETLTVLCALDENLNRTLSPDQAPLHPRVLPPPHSSSPQHEHSRPVDLPPTL
SSPAAPIVSPTTQPCGASPDHLHPQTVVHLEGFTGQSSTTDSEPSTEQGSWEESQEGPLS
RASELGNNIGEQPEKLDPTSVAHQLPHSSSSDSIESPSQSPRVVKGRAKEIESRATSQVG
LPKPPQMRRSASLAKLGYLDLCKDCSPEREPVSSESPHLKLLQPFLRTDSGMEAQEPPEN
PDTPQNREPTKYLIEQLRTTECIAQSRPVERPLAQYAKEFGSSQQCLLPRAGPGLTSSEG
GLPSVPTQGLQDTSPAPGLAVAPREQHGRTHPLRRLRKANDKKRTTNPFYNTM
Download sequence
Identical sequences E1BPN5
ENSBTAP00000014625 ENSBTAP00000014625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]