SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014883 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014883
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-51
Family Calponin-homology domain, CH-domain 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014883   Gene: ENSBTAG00000011207   Transcript: ENSBTAT00000014883
Sequence length 297
Comment pep:known chromosome:UMD3.1:7:17106394:17114222:1 gene:ENSBTAG00000011207 transcript:ENSBTAT00000014883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKVNESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERRFEPEKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHPHNYYNSA
Download sequence
Identical sequences L8IVD8 Q2HJ38
9913.ENSBTAP00000014883 ENSBTAP00000014883 ENSBTAP00000014883 NP_001039844.1.59421 NP_001039844.1.76553 XP_005890825.1.15283 XP_006063945.1.26621 XP_010826612.1.44457 XP_019819776.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]