SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014945 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014945
Domain Number 1 Region: 25-103,130-227,1188-1278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-25
Family ABC transporter ATPase domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 915-992,1056-1078,1119-1280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000779
Family ABC transporter ATPase domain-like 0.0084
Further Details:      
 
Domain Number 3 Region: 636-727
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000732
Family Rad50 coiled-coil Zn hook 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014945   Gene: ENSBTAG00000011252   Transcript: ENSBTAT00000014945
Sequence length 1312
Comment pep:known chromosome:UMD3.1:7:23062886:23169956:-1 gene:ENSBTAG00000011252 transcript:ENSBTAT00000014945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRIEKMSIQGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG
TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGEVVAVQRSMLCTQKSKKTEFKTLEGVITR
TKHGEKVSLSSKCAEIDREMISSLGVSKSVLNNVIFCHQEESNWPLSEGKALKQKFDEIF
SATRYIKALETLRQVRQTQGQKVKECQTELKYLKQNKEKACEIRDQITSKEAQLTSSREI
VKSYENELDPLKNRLKEIEQNLSKIMRLDNEIKALESRKKQMEKDNSELEQKMEKVFQGS
DEQLNDLYHNHQRTVREKERRLVDCQRELEKLNKESRLLNQEKSELLVEQGRLQLQADRH
QEHMQARDSLIQSLATQLELDGFELGPFSERQIKNFHRLVRERQEKEAETASQLLNDFVR
KEALKQKQIDEIRDKKTGLGRIIELKSEILTKKQNELKNVKYELQQLEGSSDRILELDQE
LTKAERELSKAEKNSNVETLKTEVISLQNEKADLDRTLRKLDQEMEQLNHHTATRTQMEM
LTKDKADKDEQIRKIKYRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKE
LASAEQNKNHINTELKRKEEQLSSYEDKLFDVCGSQDFESDLDRLKEEIEKSSKQRAMLA
GATAVYSQFITQLTDENQSCCPVCQRGFQTEAELQEVISDLQSKLRLAPDKLKSTESELK
KKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEEQETLLGAIIP
EEESAKVCLTDVTIMERLQMELKDVERKIAQQAAKLQGLDLDRSVQQVNQEKQEKQHKLD
TVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQLEEQTVELSTEVQS
LHREIKDAKEQLSPLETTLEKFQQEKEELINKKNTSHRTAQDKINEIKEKVKNIHSYMKD
IENYIQDGKDDYKKQKETELNKVIAQLSECDKHKEKINKEMGIMRQDIDTQKIQERWLQD
NLTLRKRNEELKEVEEERKQHLKEMGQMQVLQMKNEHQKLEEKIDNIKRNHSLAIGRQKG
YEEEIIHFKKELREPQFRDAEEKYREMMIIMRTTELVNKDLDIYYKTLDQAIMKFHSMKM
EEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGDTALDMRGR
CSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDRENIESLAHALVEIIKSRSQQR
NFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIEQCSQIVTCSVSSLGSYVH
Download sequence
Identical sequences G3X6W2
ENSBTAP00000014945 ENSBTAP00000014945 NP_001193797.1.59421 NP_001193797.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]