SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015094 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015094
Domain Number 1 Region: 1107-1246
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.12e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000178
Further Details:      
 
Domain Number 2 Region: 229-323
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000267
Family Calponin-homology domain, CH-domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015094   Gene: ENSBTAG00000011356   Transcript: ENSBTAT00000015094
Sequence length 1252
Comment pep:known_by_projection chromosome:UMD3.1:7:17671971:17688355:1 gene:ENSBTAG00000011356 transcript:ENSBTAT00000015094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEAAPPGPGPLRRTFLVPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAEHVPSELWEPF
YTDQYAQEHVKPPVTRLLFSAELYCRAWRQALPQLEAPPSPSALLALLARRGTVPALPER
PVQEADLRHQPILMGAHLAVIDALMVAFAFEWTKTLPGPLALASLEHKLLFWVDTTIRRL
QEKTEQEAAQRATPAAPADGVAPAQPSIRYRKDRAVARRAPCFPTVTSLQDLASGAALAA
TIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLK
VNLMVLLAELFMCFEVLKPDFVQVKDLPDGHAASPQATEASTPQNSGSSSPVFNFRHPLL
SPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLRPPSRPLSQAVSFSTPFGLDSDVD
VVMGDPVLLRSVSSDSLGPQRPVPARTPAQPPPETGDLPTIEEALQIIHSAEPRLLPDGA
ADGSFYLHSPEGSSKLPLASPYPLEGSSKPLPDGPTKVPAYLPHPEGPSKPAPCPAGEVS
KPPALPEGSPKVAASSPAASNSEVKMTSFAERKKQLVKAEVEAGSPVATPGAPEALSSEM
SELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKNAFLQVQPREAGGEAEAELGPAPGGE
RPAGEGQGEPSPRPKAVTFSPELGPVPPEGLGDYNRAVSKLSAALNSLQRDMQRLTDQQQ
RLLAPPESSTVAPTPAAAAWVIPGPTAGPKAASPSPARRAPAARRSHGPGPSPGPSPTPR
SPKHARPAELRLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEGPPPEEPAA
RPGLIEIPLSSLEEPAAEDEGDGSPPGAEDSLEEEVSSEGEPRTGLGFFYKDEDKPEDEM
AQKRASLLERQQRRAEEARRRKQWQEAEKEQRREEASRLVQEEVTPSPPAPTAPTASAAI
PAPAARAPAEEEVGPRRGEFTRLEYERRAQLKLMDDLDKVLRPRAAGSGGPGRGGRRAPR
PRSGCCDDSALARSPARGLLGSRLSKIYSQSTLSLSTVANEGPSNLGVKRPTSRAPSPSG
LMSPSRLPGSREREWDNGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGK
VNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSAETEELSRLAGYGPRTVTPAM
VEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGSSTPK
Download sequence
Identical sequences E1BPZ9
ENSBTAP00000015094 9913.ENSBTAP00000015094 ENSBTAP00000015094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]