SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015112 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015112
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-41
Family Phosphotyrosine-binding domain (PTB) 0.00000162
Further Details:      
 
Domain Number 2 Region: 295-406
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-28
Family SH2 domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015112   Gene: ENSBTAG00000011375   Transcript: ENSBTAT00000015112
Sequence length 413
Comment pep:known_by_projection chromosome:UMD3.1:8:90549999:90640714:1 gene:ENSBTAG00000011375 transcript:ENSBTAT00000015112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REAISRVCEAVPGSKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDS
KQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAF
ELRFKQYLQCPSKIAALHDRMQSLDEPWTEEESDGSDHPYYNSIPSKTPPPGGFADARLK
ARPHGPDTAQFAGKEQTYYQGRHLGDPFGEDWQQTPVRQGSLDIYSMPEGKSHVAPTGEA
PTYVNTQRIPQQTGPATGSSAESSPRKDLFDMKPFEDALKIQSLGPVLSKAASMECISPV
SPRAPDAKMLEELKAEPWYQGEMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHNGQA
KHLLLVDPEGTIRTKDRIFDSISHLINHHLENSLPIVSAGSELCLQQPVERNP
Download sequence
Identical sequences F1MP52
ENSBTAP00000015112 ENSBTAP00000015112 9913.ENSBTAP00000015112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]