SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015183 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015183
Domain Number 1 Region: 137-268
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000763
Family WD40-repeat 0.045
Further Details:      
 
Domain Number 2 Region: 39-119
Classification Level Classification E-value
Superfamily EF-hand 0.00000173
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015183   Gene: ENSBTAG00000011427   Transcript: ENSBTAT00000015183
Sequence length 322
Comment pep:known chromosome:UMD3.1:1:100619343:100661103:1 gene:ENSBTAG00000011427 transcript:ENSBTAT00000015183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCQNATPGLNKGSQPRPENLEKTSHGATAKEDASTVLLENQLTPGDFVQIQRAFEPSEP
SQTICMSREEFVQRMTEIVGWGTEEEYGELFDKVDVAQEGFINWDKLTSFLLLTLYEKDE
QAKATVVPQWRDLEFLPVKHKDTIQRVIFLKSSSRYLTISKEGSVGIWGENLKLQEMLPI
TSDATKLKHLWVTSMVSLENVNKIAVAFTSKEICFYDLLSKEEFPCQYKLQGLKGTPICM
DYWYNPLDANESILSFGDITGKVQVIAFTTALISLFEHPAGACEDEEATVTINWAELCSG
HHKCCYTLGHKLHHGDWVRQGT
Download sequence
Identical sequences A4IFI8
ENSBTAP00000015183 ENSBTAP00000015183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]