SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015368 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015368
Domain Number 1 Region: 846-882
Classification Level Classification E-value
Superfamily RING/U-box 0.0001
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000015368
Domain Number - Region: 52-170
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0235
Family Tricorn protease domain 2 0.048
Further Details:      
 
Domain Number - Region: 383-673
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family Clathrin adaptor core protein 0.065
Further Details:      
 
Domain Number - Region: 810-860
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0719
Family Rad50 coiled-coil Zn hook 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015368   Gene: ENSBTAG00000011567   Transcript: ENSBTAT00000015368
Sequence length 973
Comment pep:known chromosome:UMD3.1:10:36546258:36554962:1 gene:ENSBTAG00000011567 transcript:ENSBTAT00000015368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASILDEYEDSLSRSTVLQPGCPSVGIPHSGYVNAQLEKEAPIFTKQRIDFTPSERITSL
VVSCNQLCMSLGKDTLLRIDLGKANEPNHMELGRKDDAKVHKMFLDPTGSHLLIALSSTE
VLYVNRNGQKVRPLARWKGQLVESVGWNKALGTESSTGPILVGTAQGQIFEAELSASEGG
LFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPEGRGFVIATTRQRLFQFIGRVAEGAE
AQGFSGLFAAYADHPPPFREFPSSLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGSLDCG
RPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFL
EKFGPLKHMVKDSSTGHLWAHTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPD
CLDTVLAREADFCFRQRRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLASL
KPAERTQATLLTAWLTELYLSRLGALQGDPDALNLYRETRERFRSFLSSPRHKEWLFASR
ASIHELLASHGDTEHMVYFAVIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSP
ILIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGEAQQVSQAIRYMEFCVNVLGETE
QAIHNYLLSLYARGQPASLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVL
ELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASC
PLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQEL
RGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQR
KLGAAPPPAKGSARAKEAEGGTAAGGPSREQLKADLDELVAAECVYCGELMIRSIDRPFI
DPQRYEEEHLSWL
Download sequence
Identical sequences A6QR33 L8I2D4
NP_001093850.1.59421 NP_001093850.1.76553 XP_005904019.1.15283 9913.ENSBTAP00000015368 ENSBTAP00000015368 ENSBTAP00000015368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]