SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015489 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015489
Domain Number 1 Region: 224-326
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-26
Family SH2 domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-21
Family Phosphotyrosine-binding domain (PTB) 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015489   Gene: ENSBTAG00000022583   Transcript: ENSBTAT00000015489
Sequence length 344
Comment pep:known_by_projection chromosome:UMD3.1:10:61600903:61640848:1 gene:ENSBTAG00000022583 transcript:ENSBTAT00000015489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSISFASGGDPDTTDYVAYVAKDPVNQRACHILECRNGMAQDVISTIGQAFELRFKQYL
KNPSLNTSCESEEVPVDGHAEEREDHEYYNEIPGKQPPAGGVSDVRIKVQVTEQMAYCPI
RCEKLCYLPGSSKSSSMYENCLEQSRAIGNAHERGVPSQREASLMKHSCGADLFDDPCYI
NTQALRSTLGPAGNQSSPHPLGSPWPQGAAPETVQPGATAQPASSHSLPHIKQQLRNEDC
YHGKLSRKAAESLLVKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHV
FDNVGHLIRYHMDNSLPIISSGSEVSLKQPVRKDNNPGLLHSNK
Download sequence
Identical sequences E1BCR0
ENSBTAP00000015489 ENSBTAP00000015489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]