SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015660 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015660
Domain Number 1 Region: 65-166
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.97e-28
Family 2Fe-2S ferredoxin-related 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015660   Gene: ENSBTAG00000011793   Transcript: ENSBTAT00000015660
Sequence length 186
Comment pep:known chromosome:UMD3.1:15:20772630:20807409:1 gene:ENSBTAG00000011793 transcript:ENSBTAT00000015660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARLLRVASAALGDTAGRWRLLARPRAGAGGLRGSRGPGLGGGAVATRTLSVSGRAQSS
SEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQH
IFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGM
NSSKIE
Download sequence
Identical sequences P00257
ENSBTAP00000033758 ENSBTAP00000015660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]