SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015662 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015662
Domain Number 1 Region: 91-152,198-289,317-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.1e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000552
Further Details:      
 
Domain Number 2 Region: 447-575
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.44e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000918
Further Details:      
 
Domain Number 3 Region: 14-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000139
Family Thioltransferase 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015662   Gene: ENSBTAG00000011795   Transcript: ENSBTAT00000015662
Sequence length 577
Comment pep:known chromosome:UMD3.1:22:61089132:61113377:1 gene:ENSBTAG00000011795 transcript:ENSBTAT00000015662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCVWSLREENAGAFSLQVKELFSSLGVDCNILELDQVDEGASVQEALSEITSQRTVPSVF
VNRVHVGGCDHTFQAHQSGLLQQLLQQDPAYDYDLIVIGGGSGGLSCAQEAAVLGRKVMV
LDFVVPSPRGTAWGLGGTCVNVGCIPKKLMHQAALLGQALTDSRKFGWEYSQQVRHSWAT
MTEAIQSHIGSLSWGHRLALREKAVTYVNSFGEFVEHHKVKATNEKGQEVLYTAAKFVIA
TGERPRYLGIPGDREYCITSDDLFSLPYCPGATLVVGASYVALECAGFLAGLGLEVTVMV
RSVLLRGFDQEMAEKVGASMQQLGVRFLRKFVPVEVQQLERGLPGRLKVVAKSTEGTETI
EGIYNTVLLAIGRDSCTKKLGLEKIGVNVSEKTGKIPVNDEEQTSVSYVYAVGDVLEGKP
QLTPVAVQAGKLLARRLFGGRSEKCDYVNVPTVVFTPLEYGCCGYSEEKAGEVYQAENLN
VYHTLFWPLEWTVAGRDNNTCYAKIICNKLDNDRVIGFHVLGPNAGEITQGFAAAMKCGL
TKQLLDDTIGIHPTCGEVFTTLEITKASGLDITQKGC
Download sequence
Identical sequences F1MBL2
ENSBTAP00000015662 ENSBTAP00000015662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]