SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015730 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015730
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-83
Family Protein kinases, catalytic subunit 0.000000000656
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-41
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-28
Family SH3-domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015730   Gene: ENSBTAG00000011851   Transcript: ENSBTAT00000015730
Sequence length 537
Comment pep:known chromosome:UMD3.1:9:39107807:39259883:1 gene:ENSBTAG00000011851 transcript:ENSBTAT00000015730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHGAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences A0JNB0 W5PJ18
NP_001071440.1.59421 NP_001071440.1.76553 XP_004011245.1.66739 XP_005210845.1.76553 XP_005210846.1.76553 XP_005210847.1.76553 XP_005890274.1.15283 XP_005984197.1.78601 XP_006070145.1.26621 XP_006070146.1.26621 XP_006070147.1.26621 XP_010854894.1.44457 XP_010854895.1.44457 XP_011993082.1.54773 XP_011993084.1.54773 XP_011993085.1.54773 XP_011993086.1.54773 XP_011993087.1.54773 XP_012037975.1.66739 XP_012037977.1.66739 XP_012037978.1.66739 XP_017908543.1.57651 XP_017908544.1.57651 XP_019822750.1.53367 XP_019822752.1.53367 XP_020746053.1.74333 XP_020746054.1.74333 XP_020746055.1.74333 XP_020746057.1.74333 ENSBTAP00000015730 ENSBTAP00000015730 ENSOARP00000010438 9913.ENSBTAP00000015730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]