SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015733 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015733
Domain Number 1 Region: 4-171,202-216
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-53
Family Ribonuclease PH domain 1-like 0.0000000544
Further Details:      
 
Domain Number 2 Region: 187-272
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.1e-25
Family Ribonuclease PH domain 2-like 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015733   Gene: ENSBTAG00000011855   Transcript: ENSBTAT00000015733
Sequence length 276
Comment pep:known chromosome:UMD3.1:12:24708380:24717631:-1 gene:ENSBTAG00000011855 transcript:ENSBTAT00000015733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSIGTADGSALVKLGNTTVIC
GIKAEFGAPPTDAPDKGYVVPNVDLSPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQ
KEDLCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEETALAEVN
LKKKSCLNIRTHPVATSFAVFDDTLLIVDPTEEEEHLATGTLTVVMDEEGRLCCLHKPGG
SGLTGAKLQDCMSRAVTRHKEVKKLMDEVFKSMKPK
Download sequence
Identical sequences Q2KHU3
ENSBTAP00000015733 NP_001073074.1.59421 NP_001073074.1.76553 ENSBTAP00000015733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]