SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015828 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015828
Domain Number 1 Region: 3402-3640
Classification Level Classification E-value
Superfamily Plakin repeat 9.02e-88
Family Plakin repeat 0.0000000486
Further Details:      
 
Domain Number 2 Region: 3981-4219
Classification Level Classification E-value
Superfamily Plakin repeat 1.66e-87
Family Plakin repeat 0.0000000282
Further Details:      
 
Domain Number 3 Region: 179-401
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-86
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 4 Region: 2743-2983
Classification Level Classification E-value
Superfamily Plakin repeat 2.22e-86
Family Plakin repeat 0.0000000818
Further Details:      
 
Domain Number 5 Region: 3739-3976
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-77
Family Plakin repeat 0.000000821
Further Details:      
 
Domain Number 6 Region: 3071-3310
Classification Level Classification E-value
Superfamily Plakin repeat 7.72e-75
Family Plakin repeat 0.000000418
Further Details:      
 
Domain Number 7 Region: 4292-4333,4368-4562
Classification Level Classification E-value
Superfamily Plakin repeat 3.75e-71
Family Plakin repeat 0.000000309
Further Details:      
 
Domain Number 8 Region: 417-533
Classification Level Classification E-value
Superfamily Spectrin repeat 5.18e-23
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 1251-1436
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-20
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 10 Region: 745-847
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-16
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 11 Region: 592-743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000245
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 12 Region: 4239-4287
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000235
Family Plakin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015828   Gene: ENSBTAG00000011922   Transcript: ENSBTAT00000015828
Sequence length 4644
Comment pep:known_by_projection chromosome:UMD3.1:14:2054917:2088261:1 gene:ENSBTAG00000011922 transcript:ENSBTAT00000015828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMFMPLDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGL
VRETFAWRHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQ
GPLGCPPKRGPPPTEDPAREERCVYRRKEPEEGAPEPPVVPAATPGTLARQGLEPAPPTD
ERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFH
KLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDM
TAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLEN
LDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVKANELQ
LRWQEYRELVLLLLQWIRAHTAAFEERRFPSSFEEIEILWCQFLKFKETELPAKEADKNR
SKGIYQSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLERLQRIV
SKLQMEAGLCEEQLNQADALLQSQDVRLLAAGKAPQRAGEVERDLDKADGMIRLLFNDVQ
ALKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLRGTPRHPELEDSTLRYLQDLLAWVE
ENQRRLDGAEWGVDLPSVEAQLGSHRGLHQSVEEFRAKIERARTDEGQLSPATRGAYRDC
LGRLDLQYAKLLNSSKARLRSLESLHGFVAAATKELMWLSEKEEEEVGFDWSERNSNMAA
KKEAYSALMRELELKEKKIKEIQSTGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCC
IEAHLKENTAYFQFFSDVREAEEQLRKLQETLHRKYTCDRSITVTRLEDLLQDAQDEKDQ
LNEYRGHLSGLAKRAKAIVQLTPRNPTQPTRGRVPLLAVCDYKQVEATVHKGDECQMLGP
AQPFHWKVLSGSGSEAAVPSVCFLVPPPNQEALEAVARLEAQHQALVTLWHQLHTDMKSL
LAWQSLSRDVQLIRSWSLVTFRTLKPEEQRQALRSLELHYQAFLRDSQDAGGFGPEDRLQ
AEREYGSCSRHYQQLLQSLEQGKCGQCGXLDKEPARECAQRIAEQQKAQAEVEGLGKGVA
RLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGA
EEALKAHEEQLKEAQAVPAALPELEATKAAMKKLRAQAEAQQPVFDALRDELRGAQEVGE
RLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLGA
WLQDARRRQEQIQAVPLADSQAVREQLRQEKALLEEIERHAEKVEECQRFAKQYINAIKD
YELQLVTYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSELSTLTSQYIRFISETL
RRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAEREAQELQRRMQEEV
ARREEVVVDAQQQKRSIQEELQQLRQSSEAEIQAKARQVEAAERSRLRIEEEIRVVRLQL
ETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDETQRKRQAEAELGLRV
KAEAEAAREKQRALQALEELRLQAEEAERRLRQAEAERARQVQVALETAQRSAQAELQSK
HASFAEKTAQLERTLEEEHVTVVQLREEATRREQQQAEAERAREEAERELERWQLKANEA
LRLRLQAEEVAQQKSLAQAEAEKQKEAAEREARRRGKAEEQAVRQRELAEQELERQRQLA
EGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQSEAAAATQKRQELEAELAKVR
AEMEVLLASKARAEEESRSSSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAE
EDAARQRAEAERVLSEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLE
EQAAQHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEILALKASFEKAAAGK
AELELELGRIRGNAEDTLRSKEQAEQEAARQRQLAAEEERRRREAEERVQKSLAAEEEAA
RQRKAALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFAVQQK
EQELQQTLQQEQSMLERLRGEAEAARRAAEEAEEARERAEGEAAQSRQRVEEAERLKQAA
EEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALRQKQAADAEMEKHKKFAEQTLRQK
AQVEQELTALRLKLEETDHQKSILDQELQRLKAEVTEAARQRSQVEEELFSVRVQMEELG
KLKARIEAENRALILRDKDNTQRLLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDL
AQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAQET
QGFQRTLETERQRQLEMSAEAERLRLRVAEMSRAQARAEEDAQRFRKQAEEISAKLHRTE
LATQEKVTLVQTLETQRQQSDRDADRLREAIAELEREKDKLKKEAELLQLKSEEMQTVQQ
EQLLQETQALQQSFLSEKDSLLQRERFIEEEKAKLERLFQDEVAKAQKLREEQQRQQQQM
QQEKQQLLASMEEARRRQREAEEGVRRKQEELQLLEQQRQQQEQLLAEENRRLRERLEHL
EEEHRAALAHSEEITAAQAAATRALPNGQDATDGPAAEPEHAFEGLRQKVPAQQLQEAGI
LSTEEVQRLVQGHTTVAELTQREDVRRYLQGHSSIAGLLLKPANEKLTIYAALRRQLLSP
GTAVILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTG
EQISLFQAMKKDLIVREHGIRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDEEMNRVL
QDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDQAAKGGELVYTDSEARD
VFEKATVSAPFGKFQGKTVTIWELINSEYFTAEQRRDLLRQFRTGKVTVEKIIKIVITVI
EEHEQKGQLCFQGLRALVPAAELLESGVIDWDLFRQLQLGERSVQEVAEVEAVRRALRGS
GVIAGVWLEEARQKLSIYEALKKELLQPEAAVALLEAQAGTGHVIDPATSARLTVDEAVR
AGLVGPELHEKLLSAEKAVTGYKDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGI
VDPSKSHRLPLDVACARGYLDKETSTALTAPRDDAKTYYNPRTWEPATYSQLQQQCRPDP
LTGLSLLPLSEEAARARQQELYSEVQAREAFQKATVEVPVGSFQGRAVTIWELINSEYFT
AEQRQELLRQFRTGKVTVEKIIKIIITIVEEVETTRRERLSFSGLRAPVPASELLASGIL
SSSQFEQLKDGKTSVKDLSELDSVRTLLQGSGCLAGIYLEESKEKVTIYEAMRRGLLRPS
TAILLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGS
TISLFQAMKKGLVVREHGIRLLEAQIATGGIIDPVHSHRVPVDVAYQRGYFDKEMNRVLE
DPSDDTKGFFDPNTRENLTYRQLLERCVEDPETGLRLLPLKGPEKAEVVETTRVYTEEET
RRAFEETQIDIPGGGSHGGSTMSLWEVMQSDLIPEEQRAQLMADFQAGRVTKERMIIIII
EIIEKTEIVRQQNLASYDYVRRRLTAEDLHEARVISRESYSLLREGTRSLREVLEAESAW
RYLYGTGCVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGDRLT
VDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKDLIPAEEALRLLDAQ
LATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYIDPSTDERLSYTQLLRR
CRRDEASGLFLLPLSDARKLTFRGLRKQITVEELVRSHVMDEATAQRLQEGLTSIEEVSK
NLQKFLEGTSSIAGVLVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGL
KLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLL
EAQIATGGIIDPEESHRLPVDVAYQRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQ
LMERCVTDPQTGLRLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLI
DHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDEAIAKSLIDRSALDQYR
AGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISPAVSRTQLASWSDPTEETGPVAGI
LDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPNTGERFPVTEAVNKGLVDK
IMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTP
GRVPLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRL
LEAATQSSKGYYSPYSVSGSGSTTGSRSGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYS
SSGYGRRYASGPTSSLGGPESTAA
Download sequence
Identical sequences E1BF59
ENSBTAP00000015828 ENSBTAP00000015828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]