SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015846 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015846
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 2.68e-54
Family C-type lysozyme 0.000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015846   Gene: ENSBTAG00000011941   Transcript: ENSBTAT00000015846
Sequence length 148
Comment pep:known chromosome:UMD3.1:5:44351615:44357569:-1 gene:ENSBTAG00000011941 transcript:ENSBTAT00000015846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLIVGLLLLSVAVQGKKFQRCELARTLKKLGLDGYRGVSLANWVCLARWESNYNTRA
TNYNRGDKSTDYGIFQINSRWWCNDGKTPKAVNACRIPCSALLKDDITQAVACAKRVVRD
PQGIKAWVAWRNKCQNRDLRSYVQGCRV
Download sequence
Identical sequences Q6B411
NP_001071297.1.59421 NP_001071297.1.76553 ENSBTAP00000015846 ENSBTAP00000015846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]