SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015890 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015890
Domain Number 1 Region: 424-529
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 561-665
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Domain Number 3 Region: 6-111
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000684
Further Details:      
 
Domain Number 4 Region: 145-250
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 5 Region: 282-387
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000696
Further Details:      
 
Domain Number 6 Region: 1168-1278
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000679
Further Details:      
 
Domain Number 7 Region: 1297-1409
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-34
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 8 Region: 1040-1150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-33
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015890   Gene: ENSBTAG00000022715   Transcript: ENSBTAT00000015890
Sequence length 1751
Comment pep:known_by_projection chromosome:UMD3.1:26:42782329:42813472:1 gene:ENSBTAG00000022715 transcript:ENSBTAT00000015890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTESGLALRLVNGEHRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGSAISAPGG
ARFGQGSGPIVLDDVGCSGYETYLWSCSHSPWNSHNCGHSEDASVICSGAQTQSTVVPDW
WYPTTHYGDKESDFSCLLPGTESGLALRLVNGEHRCQGRVEVLYRGSWGTVCDDSWDTND
ANVVCRQLGCGLAISAPGNARFGQGSGPIVLDDVGCSGYETYLWSCSHSPWNSHNCGHSE
DASVICSGGSQSSPSPPMIFNNSKEKQEADFSCLLLGTESGLALRLVNGGDRCQGRVEVL
YRGSWGTVCDDSWDTNDANVVCRQLGCGSAISAPGGARFGQGSGPIVLDDVGCSGYETYL
WSCSHSPWNTHNCGHSEDASVICSGGSQSCSVSPPDWWYPTTDYATETQTTVVPGLLLGT
ESGLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGSAISAPGGAR
FGQGSGPIVLDDVGCSGYETYLWSCSHSPWNTHNCGHSEDASVICSGGSQSSPSPPMIFK
NSKEKQEADFSCLLPGTESGLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVV
CRQLGCGWAISAPGDARFGQGSGPIVLDDVGCSGHETYLWSCSHSPWNSHNCGHSEDASV
ICSDILIPSRSTVYISLSLEILLVLCLFSPWVCRLRITKTTNQMESDISLHAPVQTRGKR
AQVCQEVSEDPVSFLSGSIKAASLAIDSGSSVSSRHRGNHLDFGNKGCWSAGTSQESIFE
LSITPVTPVEPLLHYVSDLPSYISSACSRFPPPHRAPYSSSSFSLPLPMIHSLSDGRLQP
MASEIAQIFADVCEERYARLMFPIQLLGATPRPPFSGREGAGHSASLRKLHQESTSPLQV
SPGSPTQPGLSLAFHPLRFPEREEQTLPGESFLSEDSNRFSDQPSPQDQGCHSAVPGETS
GPLPPPAACACSGHLKTSGAKIGRCASVHASPFGQSPSRWNGQGTEKSCRKEKDFLRTLT
QKTTAGHNTPGDPPQCSFSSCGGFLFSASGNFSSPSYPGYYPNNADCVWEIQVNPGYLIN
LGFDSLQLETHSSCSYDYVEILNGPLSSNASARRICRYTREIFTSYSNRLTVRFRSDGSV
QKTGFSAWYNSLYLLGDGVITSYSMCLSDVSLRLVNWNSSHPTCAGRVEIYHGGQWGTVC
DDNWDVQDAQVVCRQLGCGYAVSAPGNAYFGSGSGPITLDDVVCSGAESNLWQCRNRGWF
YHNCGHHEDAGVICSDIPTNSSTPDWLSPTTTPTQIPTACGGFLTQFSGNFSSPFYPRNY
PNNAKCVWDIEVQNNYRVTVTFRDVQLEGGCNYDYIEVYDGPHHSSPLLARVCDGSRGSF
TSSSNFISIRFISDISITKRGFSAEYFSILSNENTKLLCLQNHMEARVRTSYLQSLGYSV
RDLAIPGSDSSYQCQPQITSSLVTFVIPYSGCGTIQQVDNDTITYSNFLKATASRSIINR
KRDLQIHVSCKMLQNTWVNTVYVTNDTIDIENTQYGNFDVNISFYTSSSFLYPVTSSPYY
VDLNQNLYLQAEILRSNPSLALFVDTCVASPNPNDFTSLTYDLIQSGCVKDETYRSYHQP
SSNIVRFKFSSFHFLNRFPSVYLKCKMVVCRAYDPFSRCNRGCIVRAKRDVSSYQEKVDV
VLGPIQLQASPQKRNLDRQVVDIEEETSTRGSYHTATIFAGVLVVMVVAVAAFALGRRVR
AACAQPPSTKM
Download sequence
Identical sequences F1MD73
ENSBTAP00000015890 ENSBTAP00000015890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]