SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015915 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015915
Domain Number 1 Region: 6-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.54e-83
Family Eukaryotic proteases 0.0000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015915   Gene: ENSBTAG00000011995   Transcript: ENSBTAT00000015915
Sequence length 263
Comment pep:known chromosome:UMD3.1:18:2604152:2607410:1 gene:ENSBTAG00000011995 transcript:ENSBTAT00000015915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFLWLLSYCALLGTAFGCGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFC
GGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINND
ITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPL
LSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCST
STPGVYARVTALVNWVQQTLAAN
Download sequence
Identical sequences G1K1L9
9913.ENSBTAP00000015915 ENSBTAP00000015915 XP_003583409.3.59421 XP_003587247.3.76553 XP_019834384.1.53367 ENSBTAP00000015915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]