SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015986 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015986
Domain Number 1 Region: 843-1120
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-72
Family Protein kinases, catalytic subunit 0.00000435
Further Details:      
 
Domain Number 2 Region: 523-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.51e-49
Family Protein kinases, catalytic subunit 0.0000664
Further Details:      
 
Domain Number 3 Region: 371-500
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-19
Family SH2 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 279-386
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-16
Family Third domain of FERM 0.02
Further Details:      
 
Domain Number 5 Region: 141-261
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000209
Family Second domain of FERM 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015986   Gene: ENSBTAG00000012047   Transcript: ENSBTAT00000015986
Sequence length 1133
Comment pep:known_by_projection chromosome:UMD3.1:8:39632638:39719731:-1 gene:ENSBTAG00000012047 transcript:ENSBTAT00000015986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMACLTMTEMEGTSTSPVHQNGDISGNANSVKQIDPVLQVYLYHSLGNAEGDYLQFLTG
EYVAEEICIAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESTRQNVLYRIRFYF
PYWYCNGSNRTYRHGIARGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKNQTPLDIYSSISYKTFLPKCVRAKIQEYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDISIKQANQEGANESRIVTIHKQDGKSLEIELKSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPISMDFAISKLKKTGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVPTSPTLQRHNNVNQMVFHKI
RNEDLVFNESLGQGTFTKIFKGIRREIGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLILNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDKVLQERIPWV
PPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTE
LANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDR
DPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREI
EILKSLQHDNIVKYKGVCYSAGRHNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQ
ICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIF
WYAPESLTESKFSVASDVWSFGVVLYELFTYIDKSKSPPAEFMRMIGNDKQGQMIVFHLI
ELLKNNGRLPRPDGCPDEIYVIMTECWNNNVNQRPSFRDLAVRVDQIRDNMTG
Download sequence
Identical sequences E1BCP6
ENSBTAP00000015986 ENSBTAP00000015986 9913.ENSBTAP00000015986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]