SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016009 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000016009
Domain Number - Region: 15-73
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0366
Family Rad50 coiled-coil Zn hook 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016009   Gene: ENSBTAG00000012069   Transcript: ENSBTAT00000016009
Sequence length 97
Comment pep:known chromosome:UMD3.1:23:11358158:11373693:-1 gene:ENSBTAG00000012069 transcript:ENSBTAT00000016009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKKRENLGVALEIDGLEKKLSQCRRDLEVVNSRLCGVELSSEARRSLEKEKSSLMNKA
SNYEKELKLLRQENRKNMLLSVAIFLLLTVIYAYWAL
Download sequence
Identical sequences A1A4P9
ENSBTAP00000016009 ENSBTAP00000016009 NP_001073705.1.59421 NP_001073705.1.76553 XP_005906841.1.15283 XP_010846991.1.44457 XP_019841514.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]