SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016306 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016306
Domain Number 1 Region: 117-174
Classification Level Classification E-value
Superfamily EF-hand 0.000000124
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016306   Gene: ENSBTAG00000012295   Transcript: ENSBTAT00000016306
Sequence length 471
Comment pep:known chromosome:UMD3.1:18:19032743:19124256:1 gene:ENSBTAG00000012295 transcript:ENSBTAT00000016306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGSSGPRQLRAAGTVG
RGARELVGEVFRETLSEEEEEDFRLEVALPPEKSDGLASGDEKRMEKSGEPCSGSKKQLK
FEELQCDVSVEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKT
LRVKLTVAPDGSQSKKSIVLNHPDLQSARPRAETKPAEELRSWEKKQRALLRFQGDSHLE
QSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRASNPTRSRSHEP
EAIHVPHRKPQGADPGSFHFLDAPFAKASEVQQRLRGGTQDGSKHFVRSPKAQGKSVGVG
HVARGARSKPPGGPAVPAVAPSAHLAASPALLPTLAPLGHRKHKHRAKESQQGCRGLQAP
LAVGGTVVGRDHLRELPAVVVYESQAGQAVQRHEHHHHHEHHHHYHHFYQT
Download sequence
Identical sequences A7Z042
ENSBTAP00000016306 NP_001098923.1.59421 NP_001098923.1.76553 9913.ENSBTAP00000016306 ENSBTAP00000016306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]