SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016315 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016315
Domain Number 1 Region: 88-188
Classification Level Classification E-value
Superfamily EF-hand 1.32e-29
Family Eps15 homology domain (EH domain) 0.00000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016315   Gene: ENSBTAG00000031261   Transcript: ENSBTAT00000016315
Sequence length 478
Comment pep:known_by_projection chromosome:UMD3.1:X:133563712:133706966:-1 gene:ENSBTAG00000031261 transcript:ENSBTAT00000016315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQETQSPSMSPLASPPSSPPHYQRVPLSHGYSKLRSSTEQMHSAPYEARQPLVQPEGPST
GGPGAKPPRHQASLIRSFSVERELQDNSTSYPDEPWRITEEQREYYVNQFRSLQPDPSSF
ISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGL
PPTLQPEYLQAAFPKPKWECALFDSYSESIPANQQPRDLNRMEKLSIKDMADFPVPTQDV
TGDDKQALKSATDEALPKDMSEDSATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTP
PPRPQKTHSRASSLDLNKVFQPSVPASKSGLLPPPPALPPRPCPSQSEQASEAEVHPQLN
RAPSQAAESSPTKKEIPYSQPPSKPIRRKFRPENQATENQEPSTTVGGPASVATVKPHPA
VQKQSSKQKKAIQTAIRKNKEANAVLARLNSELQQQLKVKSFLNLDNQALCLVVVFCF
Download sequence
Identical sequences F1MZ73
ENSBTAP00000016315 ENSBTAP00000016315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]