SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016319 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016319
Domain Number 1 Region: 276-371
Classification Level Classification E-value
Superfamily EF-hand 6.23e-29
Family Eps15 homology domain (EH domain) 0.00000594
Further Details:      
 
Domain Number 2 Region: 4-97
Classification Level Classification E-value
Superfamily EF-hand 0.00000000002
Family Eps15 homology domain (EH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016319   Gene: ENSBTAG00000012299   Transcript: ENSBTAT00000016319
Sequence length 795
Comment pep:known chromosome:UMD3.1:9:77666178:77757440:-1 gene:ENSBTAG00000012299 transcript:ENSBTAT00000016319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLTLSDAEQKYYSDLFSYCDIESTKKVSANGRVLELFRAAQLPNDVVLQIMELCGATR
LGYFGRSQFYIALKLVAVAQSGFPLRVESINTVKDLPLPRFVASKNEQESRHPTSYSSDS
ENQGSYSGVIPPPPGRGQVKKGSTSHDTVQPRASVDQQEPVSPVVSPQQSPPASPHTWRK
HNRHPSGGNSERPLAGPGPFWSPFGEAQSGSSAGDAVWSGHSPPPPQENWVSFADTPPTS
TLLTMHPASVQDQTTVRTVASATTANEIRRQSSSYDDPWKITDEQRQYYVNQFKTIQPDL
NGFIPGSAAKEFFTKSKLPILELSHIWELSDFDKDGALTLDEFCAAFHLVVARKNGYDLP
EKLPESLMPKLIDLEDSADVGDQPGEVGYSGSPAEAPPSKSPSMPSLNQTWPELNQSSEQ
WETFSERSSSSQTLTQFDSNIAPADPDTAIVHPVPIRMTPSKIHMQEMELKRTGSDHTNP
TSPLLVKTSDLSEENKINSSVKFASGNTVADGYSSSDSFTSDPEQIGNNVTRQSSHSQKS
PENTAPPPPPPRPQPSHSRSSSLDMNRTFSVTTGQQQAGVVAQPPAVPPRPQPSQAPGPV
VHRPVDADGLITHTSTSPQQIPEQPNFADFSQFEVFAASNVNEEQDDEAEKHPEVLPVEK
SSDPASSRVAKTDSKIEEKTAASAPANVSKGTTPLAPPPKPVRRRLKSEDELRPEVDEHT
QKTGVLAAVLASQPSIPRSVGKDKKAIQASIRRNKETNTVLARLNSELQQQLKDVLEERI
SLEVQLEQLRPFSHL
Download sequence
Identical sequences F6Q4T4
ENSBTAP00000016319 ENSBTAP00000016319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]