SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016592 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016592
Domain Number 1 Region: 207-282
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.32e-26
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.22e-25
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016592   Gene: ENSBTAG00000012504   Transcript: ENSBTAT00000016592
Sequence length 679
Comment pep:known chromosome:UMD3.1:17:70719230:70724693:1 gene:ENSBTAG00000012504 transcript:ENSBTAT00000016592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPSGGDGFLTGLATGT
TLCQHANAVTEAARAMAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRAELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRATPPASNTPSA
GEDTTETTATPGAPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSAAHRPPQPRTRTFSPQRVSPSP
SPRAGSPAPGVERRGSRPEVTPIGLRSSKEGPETPLRARDQLPPHPRSRRYSGDSDSSAS
SAQSGPLGARSEDSGTGPRRERPSRRVTTGTPVSPRRPPAPRSQSRDRLDRGRPRGAPGG
RGGQLSAPSPARRARSQSREEQTVLLVRRDRDGQHSWVPRGRGSGGSGRSSPHTPRAHSP
AAPRVPSPSPELSTIPASVFRTPLQLDPKQEQQLFRRLEEEFLANARALEAAAAGGTPSG
PAPDPIRAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQPGDSGRMANGLPGPRGPALSSSS
DEGSPCPGVGGPPDAPGSPLAGPEPLRTWARGRMDTQPDRKPSRIPTPRGPRRPPGPTGS
RTWHALRSVSPKTEPDSWM
Download sequence
Identical sequences F1MVK6
ENSBTAP00000016592 XP_015331040.1.76553 9913.ENSBTAP00000016592 ENSBTAP00000016592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]