SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016644 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016644
Domain Number 1 Region: 14-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.93e-84
Family Eukaryotic proteases 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016644   Gene: ENSBTAG00000012538   Transcript: ENSBTAT00000016644
Sequence length 259
Comment pep:known_by_projection chromosome:UMD3.1:18:57495324:57499297:-1 gene:ENSBTAG00000012538 transcript:ENSBTAT00000016644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGWESFCLPASPTLAHRCLLLAMAQNQGNEKIIGGYTCTQGSQPWQAALLQGPQRRFLC
GGSLLSDQWVITAAHCARPILRVALGKHNLKIPEATQQVLRVVRKVPHPRYNSRTNDNDL
MLLQLERPARLGPRVRPISVASSCARVGSSCLVSGWGTISSPVARYPNSLQCVNINISSD
QECRRAYSGAITPGMVCAGVPQGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAQPGYPG
VYTNLCKYHTWIQGTIRRR
Download sequence
Identical sequences F1MXS5
ENSBTAP00000016644 ENSBTAP00000016644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]