SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016647 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016647
Domain Number 1 Region: 6-190
Classification Level Classification E-value
Superfamily EF-hand 2.46e-33
Family Calmodulin-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016647   Gene: ENSBTAG00000012541   Transcript: ENSBTAT00000016647
Sequence length 196
Comment pep:known chromosome:UMD3.1:25:21657896:21661311:1 gene:ENSBTAG00000012541 transcript:ENSBTAT00000016647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRSSHAARIPDVDSLRQETGFSQASLRRLYDRFNALDRTGKGYLSRMDLQQIGALAVN
PLGDRIIDSFFPDGSLRLDFPGFVRVLAHFRPVDEEDDGNRDPKEPEPLNSRMNKLRFAF
QLYDLDRDGKISRHEMLQALRLMVGVQVTEEQLESIADRTVQEADEDGDGAVSFLEFAKS
LEKMNIEQKMSIRILK
Download sequence
Identical sequences E1BHF5
9913.ENSBTAP00000016647 NP_001179334.1.59421 NP_001179334.1.76553 ENSBTAP00000016647 ENSBTAP00000016647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]