SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016774 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016774
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily EF-hand 1.73e-19
Family S100 proteins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016774   Gene: ENSBTAG00000012640   Transcript: ENSBTAT00000016774
Sequence length 89
Comment pep:known chromosome:UMD3.1:3:17146918:17147898:1 gene:ENSBTAG00000012640 transcript:ENSBTAT00000016774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTDLECAINSLIDVYHKYSLKKGNYHAVYRDDLKQLLETECPKFMKKKDADTWFKELDI
NQDGGINFEEFLVLVIKVGLEAHEEIHKE
Download sequence
Identical sequences I6WCE3 I6XM79 P28782
ENSBTAP00000016774 NP_001107197.1.59421 NP_001107197.1.76553 XP_019813909.1.53367 XP_019813910.1.53367 ENSBTAP00000016774 9913.ENSBTAP00000016774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]