SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016779 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016779
Domain Number 1 Region: 31-328
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.13e-63
Family Bacterial PLC 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016779   Gene: ENSBTAG00000012646   Transcript: ENSBTAT00000016779
Sequence length 340
Comment pep:known_by_projection chromosome:UMD3.1:1:56844455:56894475:1 gene:ENSBTAG00000012646 transcript:ENSBTAT00000016779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAFRKVRRKLRMGTICSPNPSGTKTLEVCNADWMASLPSHLHNVPLSNLAIPGSHDSFS
YWVDEKSPVGPDQTPAIKRLARISFVKKVMKKWSVTQNLTFREQLDAGIRYFDLRVSSKP
GDADQEIYFIHGLFGIKVWDGLMEINSFLTQHPQEIVFLDFNHFYAMDEAHHKRLILRIQ
EAFGSKLCSACSVESMTLQRLWEKKYQVLIFYHCPFYKQYAFLWPGKKIPAPWANTTSVR
KLILFLETTLSERSPHGSFHVSQAILTPRVKTIARGLVGGLKNTLVHRNLPAILDWVKTQ
KPGAMGVNIITSDFVDLVDFATTVIELNDLLQEDRALAKC
Download sequence
Identical sequences F1MUI9
XP_005196113.1.59421 XP_005201408.1.76553 ENSBTAP00000016779 ENSBTAP00000016779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]