SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016852 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016852
Domain Number 1 Region: 41-206
Classification Level Classification E-value
Superfamily EF-hand 9.1e-37
Family Calmodulin-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016852   Gene: ENSBTAG00000012688   Transcript: ENSBTAT00000016852
Sequence length 208
Comment pep:known_by_projection chromosome:UMD3.1:20:38272477:38300277:1 gene:ENSBTAG00000012688 transcript:ENSBTAT00000016852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTARHDREMAIQAKKKLTVATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLD
FKEFVKGLNDYAVVMEKEEAEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAF
RKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGVVTPEE
FMNYYAGVSASIDTDVYFIVMMRTAWKL
Download sequence
Identical sequences F1MV68 L8HLJ1 W5PNH8
XP_005694858.1.57651 XP_005911420.1.15283 XP_005956001.1.78601 XP_010852100.1.44457 XP_010852101.1.44457 XP_011952454.1.66739 XP_011952457.1.66739 XP_011985226.1.54773 XP_011985229.1.54773 XP_015314565.1.76553 XP_015314566.1.76553 XP_019838672.1.53367 XP_019838673.1.53367 ENSBTAP00000016852 9913.ENSBTAP00000016852 ENSOARP00000012004 ENSBTAP00000016852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]