SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000017007 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000017007
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily SRP19 1.01e-38
Family SRP19 0.000000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000017007   Gene: ENSBTAG00000012803   Transcript: ENSBTAT00000017007
Sequence length 144
Comment pep:known chromosome:UMD3.1:10:1102150:1110236:-1 gene:ENSBTAG00000012803 transcript:ENSBTAT00000017007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCAAVGLNV
FLEKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
KTGGGDQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences L8I742 Q3ZBG7
NP_001029650.1.59421 NP_001029650.1.76553 XP_005685081.1.57651 XP_005902778.1.15283 XP_005962677.1.78601 XP_005981437.1.78601 XP_006056928.1.26621 XP_010846666.1.44457 XP_019823573.1.53367 ENSBTAP00000017007 9913.ENSBTAP00000017007 ENSBTAP00000017007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]